![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein 2,4-dienoyl-CoA reductase [89517] (1 species) |
![]() | Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (6 PDB entries) |
![]() | Domain d1n9gf2: 1n9g F:161-349 [91731] Other proteins in same PDB: d1n9ga1, d1n9gb1, d1n9gc1, d1n9gd1, d1n9ge1, d1n9gf1 complexed with nap, so4 |
PDB Entry: 1n9g (more details), 1.98 Å
SCOPe Domain Sequences for d1n9gf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9gf2 c.2.1.1 (F:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv irdrpnldevvaslkelgatqvitedqnnskefgptikewikqsggeaklalncvggkss tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq iiawyeegk
Timeline for d1n9gf2: