![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein 2,4-dienoyl-CoA reductase [89309] (1 species) |
![]() | Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries) |
![]() | Domain d1n9gf1: 1n9g F:23-160,F:350-386 [91730] Other proteins in same PDB: d1n9ga2, d1n9gb2, d1n9gc2, d1n9gd2, d1n9ge2, d1n9gf2 complexed with nap, so4 |
PDB Entry: 1n9g (more details), 1.98 Å
SCOPe Domain Sequences for d1n9gf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9gf1 b.35.1.2 (F:23-160,F:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity
Timeline for d1n9gf1: