SCOPe 2.07: Domain d1n9gd1: 1n9g D:23-160,D:350-386

Lineage for d1n9gd1 (1n9g D:23-160,D:350-386)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein 2,4-dienoyl-CoA reductase [89309] (1 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries)

8. Domain d1n9gd1: 1n9g D:23-160,D:350-386 [91726]
   Other proteins in same PDB: d1n9ga2, d1n9gb2, d1n9gc2, d1n9gd2, d1n9ge2, d1n9gf2
   complexed with nap, so4

Details for d1n9gd1

PDB Entry: 1n9g, 1.98 Å

PDB Description: mitochondrial 2-enoyl thioester reductase etr1p/etr2p heterodimer from candida tropicalis

PDB Compounds: (D:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1n9gd1:

Sequence; same for both SEQRES and ATOM records:

>d1n9gd1 b.35.1.2 (D:23-160,D:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

Timeline for d1n9gd1:

• d1n9gd1 first appeared in SCOP 1.67
  
• d1n9gd1 appears in SCOPe 2.06
  
• d1n9gd1 appears in the current release, SCOPe 2.08