SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1n9gc1 (1n9g C:23-160,C:350-386)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2047809Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2047810Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2047938Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 protein domains)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2047939Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
  7. 2047940Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (6 PDB entries)
  8. 2047947Domain d1n9gc1: 1n9g C:23-160,C:350-386 [91724]
    Other proteins in same PDB: d1n9ga2, d1n9gb2, d1n9gc2, d1n9gd2, d1n9ge2, d1n9gf2
    complexed with nap, so4

Details for d1n9gc1

PDB Entry: 1n9g (more details), 1.98 Å

PDB Description: Mitochondrial 2-enoyl thioester reductase Etr1p/Etr2p heterodimer from Candida tropicalis
PDB Compounds: (C:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1n9gc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9gc1 b.35.1.2 (C:23-160,C:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOPe Domain Coordinates for d1n9gc1:

Click to download the PDB-style file with coordinates for d1n9gc1.
(The format of our PDB-style files is described here.)

Timeline for d1n9gc1: