SCOP 1.73: Domain d1n9gb1: 1n9g B:23-160,B:350-386

Lineage for d1n9gb1 (1n9g B:23-160,B:350-386)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (2 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein 2,4-dienoyl-CoA reductase [89309] (1 species)

7. Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries)

8. Domain d1n9gb1: 1n9g B:23-160,B:350-386 [91722]
   Other proteins in same PDB: d1n9ga2, d1n9gb2, d1n9gc2, d1n9gd2, d1n9ge2, d1n9gf2

Details for d1n9gb1

PDB Entry: 1n9g, 1.98 Å

PDB Description: mitochondrial 2-enoyl thioester reductase etr1p/etr2p heterodimer from candida tropicalis

PDB Compounds: (B:) 2,4-dienoyl-CoA reductase

SCOP Domain Sequences for d1n9gb1:

Sequence; same for both SEQRES and ATOM records:

>d1n9gb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

Timeline for d1n9gb1:

• d1n9gb1 first appeared in SCOP 1.67
  
• d1n9gb1 appears in SCOP 1.71
  
• d1n9gb1 appears in SCOP 1.75
  
• d1n9gb1 appears in the current release, SCOPe 2.08