Lineage for d1n9ga1 (1n9g A:23-160,A:350-386)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558060Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 558061Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 558147Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 558148Protein 2,4-dienoyl-CoA reductase [89309] (1 species)
  7. 558149Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries)
  8. 558154Domain d1n9ga1: 1n9g A:23-160,A:350-386 [91720]
    Other proteins in same PDB: d1n9ga2, d1n9gb2, d1n9gc2, d1n9gd2, d1n9ge2, d1n9gf2

Details for d1n9ga1

PDB Entry: 1n9g (more details), 1.98 Å

PDB Description: mitochondrial 2-enoyl thioester reductase etr1p/etr2p heterodimer from candida tropicalis

SCOP Domain Sequences for d1n9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ga1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)}
mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk
pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity

SCOP Domain Coordinates for d1n9ga1:

Click to download the PDB-style file with coordinates for d1n9ga1.
(The format of our PDB-style files is described here.)

Timeline for d1n9ga1: