| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species) |
| Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (3 PDB entries) Uniprot Q96X16 43-777 |
| Domain d1n9ed3: 1n9e D:170-315 [91719] Other proteins in same PDB: d1n9ea1, d1n9eb1, d1n9ec1, d1n9ed1 complexed with ca, cu, nag, so4 |
PDB Entry: 1n9e (more details), 1.65 Å
SCOPe Domain Sequences for d1n9ed3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9ed3 d.17.2.1 (D:170-315) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]}
evghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvd
ygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkdd
fvtlpkidvdnldwtviqrndsapir
Timeline for d1n9ed3: