![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species) |
![]() | Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (3 PDB entries) Uniprot Q96X16 43-777 |
![]() | Domain d1n9ed2: 1n9e D:41-169 [91718] Other proteins in same PDB: d1n9ea1, d1n9eb1, d1n9ec1, d1n9ed1 complexed with ca, cu, nag, so4 |
PDB Entry: 1n9e (more details), 1.65 Å
SCOPe Domain Sequences for d1n9ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9ed2 d.17.2.1 (D:41-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]} asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn tngksklpf
Timeline for d1n9ed2: