Lineage for d1n9ed2 (1n9e D:41-169)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181140Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 2181141Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2181393Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species)
  7. 2181394Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (3 PDB entries)
    Uniprot Q96X16 43-777
  8. 2181405Domain d1n9ed2: 1n9e D:41-169 [91718]
    Other proteins in same PDB: d1n9ea1, d1n9eb1, d1n9ec1, d1n9ed1
    complexed with ca, cu, nag, so4

Details for d1n9ed2

PDB Entry: 1n9e (more details), 1.65 Å

PDB Description: crystal structure of pichia pastoris lysyl oxidase pplo
PDB Compounds: (D:) lysyl oxidase

SCOPe Domain Sequences for d1n9ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ed2 d.17.2.1 (D:41-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]}
asaecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwiet
lkpnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyn
tngksklpf

SCOPe Domain Coordinates for d1n9ed2:

Click to download the PDB-style file with coordinates for d1n9ed2.
(The format of our PDB-style files is described here.)

Timeline for d1n9ed2: