Lineage for d1n9eb3 (1n9e B:170-315)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 408884Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 408949Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 408950Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 409064Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species)
  7. 409065Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (1 PDB entry)
  8. 409069Domain d1n9eb3: 1n9e B:170-315 [91713]
    Other proteins in same PDB: d1n9ea1, d1n9eb1, d1n9ec1, d1n9ed1

Details for d1n9eb3

PDB Entry: 1n9e (more details), 1.65 Å

PDB Description: crystal structure of pichia pastoris lysyl oxidase pplo

SCOP Domain Sequences for d1n9eb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9eb3 d.17.2.1 (B:170-315) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris)}
evghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvd
ygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkdd
fvtlpkidvdnldwtviqrndsapir

SCOP Domain Coordinates for d1n9eb3:

Click to download the PDB-style file with coordinates for d1n9eb3.
(The format of our PDB-style files is described here.)

Timeline for d1n9eb3: