Lineage for d1n9ea1 (1n9e A:316-775)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782204Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1782205Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 1782206Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 1782335Protein Lysyl oxidase PplO, domain 3 [101663] (1 species)
  7. 1782336Species Yeast (Pichia pastoris) [TaxId:4922] [101664] (3 PDB entries)
    Uniprot Q96X16 43-777
  8. 1782339Domain d1n9ea1: 1n9e A:316-775 [91708]
    Other proteins in same PDB: d1n9ea2, d1n9ea3, d1n9eb2, d1n9eb3, d1n9ec2, d1n9ec3, d1n9ed2, d1n9ed3
    complexed with ca, cu, nag, so4

Details for d1n9ea1

PDB Entry: 1n9e (more details), 1.65 Å

PDB Description: crystal structure of pichia pastoris lysyl oxidase pplo
PDB Compounds: (A:) lysyl oxidase

SCOPe Domain Sequences for d1n9ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9ea1 b.30.2.1 (A:316-775) Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastoris) [TaxId: 4922]}
hlddrksprlvepegrrwaydgeeeyfswmdwgfytswsrdtgisfyditfkgerivyel
slqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpatagyfttdtfeydefynr
tlsycvfenqedysllrhtgasysaitqnptlnvrfistignydynflykffldgtlevs
vraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldvggtknraskyvmkdv
dveypwapgtvyntkqiarevlekedfnginwpengqgilliesaeetnsfgnpraynim
pggggvhrivknsrsgpetqnwarsnlfltkhkdeelrsstalntnalydppvnfnafld
desldgedivawvnlglhhlpnsndlpntifstahasfmltpfnyfdsensrdttqqvfy
tyddeteesnwefygndwsscglevpepnfedytygrgtr

SCOPe Domain Coordinates for d1n9ea1:

Click to download the PDB-style file with coordinates for d1n9ea1.
(The format of our PDB-style files is described here.)

Timeline for d1n9ea1: