Lineage for d1n8na_ (1n8n A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011080Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 1011081Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 1011082Species Escherichia coli [TaxId:562] [102309] (11 PDB entries)
    Uniprot P32697 27-237
  8. 1011093Domain d1n8na_: 1n8n A: [91706]
    complexed with au3

Details for d1n8na_

PDB Entry: 1n8n (more details), 1.69 Å

PDB Description: Crystal structure of the Au3+ complex of AphA class B acid phosphatase/phosphotransferase from E. coli at 1.69 A resolution
PDB Compounds: (A:) Class B acid phosphatase

SCOPe Domain Sequences for d1n8na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8na_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

SCOPe Domain Coordinates for d1n8na_:

Click to download the PDB-style file with coordinates for d1n8na_.
(The format of our PDB-style files is described here.)

Timeline for d1n8na_: