Lineage for d1n82b_ (1n82 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 384982Protein Xylanase [51488] (5 species)
  7. 384983Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (1 PDB entry)
    intra-cellular xylanase
  8. 384985Domain d1n82b_: 1n82 B: [91704]
    complexed with gol, na

Details for d1n82b_

PDB Entry: 1n82 (more details), 1.45 Å

PDB Description: the high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from g. stearothermophilus

SCOP Domain Sequences for d1n82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n82b_ c.1.8.3 (B:) Xylanase {Bacillus stearothermophilus, Ixt6}
slpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftfqe
adrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrryk
gkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndynecf
pekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhiteld
vsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwldnf
pvhgrknwpllfdeqhkpkpafwravsv

SCOP Domain Coordinates for d1n82b_:

Click to download the PDB-style file with coordinates for d1n82b_.
(The format of our PDB-style files is described here.)

Timeline for d1n82b_: