Lineage for d1n7jb_ (1n7j B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129610Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 protein domains)
    automatically mapped to Pfam PF01234
  6. 2129614Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)
  7. 2129615Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries)
  8. 2129629Domain d1n7jb_: 1n7j B: [91697]
    complexed with idi, sah

Details for d1n7jb_

PDB Entry: 1n7j (more details), 2.7 Å

PDB Description: The structure of Phenylethanolamine N-methyltransferase in complex with S-adenosylhomocysteine and an iodinated inhibitor
PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d1n7jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n7jb_ c.66.1.15 (B:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkv

SCOPe Domain Coordinates for d1n7jb_:

Click to download the PDB-style file with coordinates for d1n7jb_.
(The format of our PDB-style files is described here.)

Timeline for d1n7jb_: