SCOPe 2.05: Domain d1n7ia_: 1n7i A:

Lineage for d1n7ia_ (1n7i A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries)

8. Domain d1n7ia_: 1n7i A: [91694]
   complexed with ly1, sah

Details for d1n7ia_

PDB Entry: 1n7i, 2.8 Å

PDB Description: The structure of Phenylethanolamine N-methyltransferase in complex with S-adenosylhomocysteine and the inhibitor LY134046

PDB Compounds: (A:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d1n7ia_:

Sequence; same for both SEQRES and ATOM records:

>d1n7ia_ c.66.1.15 (A:) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
avasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigsg
ptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecwq
dkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldhi
ttllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpah
lqtgvddvkgvffawaqkvgl

Timeline for d1n7ia_:

• d1n7ia_ first appeared in SCOP 1.67
  
• d1n7ia_ appears in SCOPe 2.04
  
• d1n7ia_ appears in SCOPe 2.06
  
• d1n7ia_ appears in the current release, SCOPe 2.08