SCOPe 2.05: Domain d1n7fa_: 1n7f A:

Lineage for d1n7fa_ (1n7f A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Glutamate receptor-interacting protein 1, GRIP1 [101717] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101718] (2 PDB entries)

8. Domain d1n7fa_: 1n7f A: [91692]
   sixth PDZ domain; complexed with liprin C-terminal peptide, chains C and D

Details for d1n7fa_

PDB Entry: 1n7f, 1.8 Å

PDB Description: Crystal structure of the sixth PDZ domain of GRIP1 in complex with liprin C-terminal peptide

PDB Compounds: (A:) AMPA receptor interacting protein GRIP

SCOPe Domain Sequences for d1n7fa_:

Sequence; same for both SEQRES and ATOM records:

>d1n7fa_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
aiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilainsssl
kgkplseaihllqmagetvtlkikkq

Timeline for d1n7fa_:

• d1n7fa_ first appeared in SCOP 1.67
  
• d1n7fa_ appears in SCOPe 2.04
  
• d1n7fa_ appears in SCOPe 2.06
  
• d1n7fa_ appears in the current release, SCOPe 2.08