SCOP 1.67: Domain d1n7fa_: 1n7f A:

Lineage for d1n7fa_ (1n7f A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (24 proteins)

6. Protein Glutamate receptor-interacting protein 1, GRIP1 [101717] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [101718] (2 PDB entries)

8. Domain d1n7fa_: 1n7f A: [91692]

Details for d1n7fa_

PDB Entry: 1n7f, 1.8 Å

PDB Description: Crystal structure of the sixth PDZ domain of GRIP1 in complex with liprin C-terminal peptide

SCOP Domain Sequences for d1n7fa_:

Sequence; same for both SEQRES and ATOM records:

>d1n7fa_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus)}
aiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilainsssl
kgkplseaihllqmagetvtlkikkq

Timeline for d1n7fa_:

• d1n7fa_ is new in SCOP 1.67
  
• d1n7fa_ appears in SCOP 1.69
  
• d1n7fa_ appears in the current release, SCOPe 2.08