Lineage for d1n6ma_ (1n6m A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111634Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
    contains coiled-coil neck
  7. 2111642Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [52650] (4 PDB entries)
  8. 2111644Domain d1n6ma_: 1n6m A: [91688]
    complexed with adp, mg

Details for d1n6ma_

PDB Entry: 1n6m (more details), 2.5 Å

PDB Description: Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor protein, Ncd
PDB Compounds: (A:) Claret segregational protein

SCOPe Domain Sequences for d1n6ma_:

Sequence, based on SEQRES records: (download)

>d1n6ma_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
femvspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnl
gweyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhl
mhtakmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktst
rmtetknikrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfq
dcfqesvkslrfaasvnsck

Sequence, based on observed residues (ATOM records): (download)

>d1n6ma_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
fcrirppleseenrmcctwtyhdestvelqsidaqmgqqifsfdqvfhplssqsdifemv
spliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwey
eikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhta
kmnrassrshavtkleligrhaekqeisvgsinlvdlagsespktetknikrslseltnv
ilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvns
ck

SCOPe Domain Coordinates for d1n6ma_:

Click to download the PDB-style file with coordinates for d1n6ma_.
(The format of our PDB-style files is described here.)

Timeline for d1n6ma_: