Lineage for d1n6jb_ (1n6j B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569729Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2569730Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2569731Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2569744Protein Myocyte enhancer factor Mef2b core [103117] (1 species)
  7. 2569745Species Human (Homo sapiens) [TaxId:9606] [103118] (3 PDB entries)
    Uniprot Q02080 2-91
  8. 2569747Domain d1n6jb_: 1n6j B: [91687]
    complexed with a cabin 1 peptide, chain G
    protein/DNA complex

Details for d1n6jb_

PDB Entry: 1n6j (more details), 2.2 Å

PDB Description: structural basis of sequence-specific recruitment of histone deacetylases by myocyte enhancer factor-2
PDB Compounds: (B:) Myocyte-specific enhancer factor 2B

SCOPe Domain Sequences for d1n6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6jb_ d.88.1.1 (B:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrr

SCOPe Domain Coordinates for d1n6jb_:

Click to download the PDB-style file with coordinates for d1n6jb_.
(The format of our PDB-style files is described here.)

Timeline for d1n6jb_: