Lineage for d1n6ja_ (1n6j A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 415295Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 415296Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 415297Family d.88.1.1: SRF-like [55456] (4 proteins)
  6. 415310Protein Myocyte enhancer factor Mef2b core [103117] (1 species)
  7. 415311Species Human (Homo sapiens) [TaxId:9606] [103118] (1 PDB entry)
  8. 415312Domain d1n6ja_: 1n6j A: [91686]

Details for d1n6ja_

PDB Entry: 1n6j (more details), 2.2 Å

PDB Description: structural basis of sequence-specific recruitment of histone deacetylases by myocyte enhancer factor-2

SCOP Domain Sequences for d1n6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ja_ d.88.1.1 (A:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens)}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrrgig

SCOP Domain Coordinates for d1n6ja_:

Click to download the PDB-style file with coordinates for d1n6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1n6ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n6jb_