Lineage for d1n6ja_ (1n6j A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963102Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2963103Superfamily d.88.1: SRF-like [55455] (2 families) (S)
  5. 2963104Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2963117Protein Myocyte enhancer factor Mef2b core [103117] (1 species)
  7. 2963118Species Human (Homo sapiens) [TaxId:9606] [103118] (3 PDB entries)
    Uniprot Q02080 2-91
  8. 2963119Domain d1n6ja_: 1n6j A: [91686]
    complexed with a cabin 1 peptide, chain G
    protein/DNA complex

Details for d1n6ja_

PDB Entry: 1n6j (more details), 2.2 Å

PDB Description: structural basis of sequence-specific recruitment of histone deacetylases by myocyte enhancer factor-2
PDB Compounds: (A:) Myocyte-specific enhancer factor 2B

SCOPe Domain Sequences for d1n6ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ja_ d.88.1.1 (A:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrrgig

SCOPe Domain Coordinates for d1n6ja_:

Click to download the PDB-style file with coordinates for d1n6ja_.
(The format of our PDB-style files is described here.)

Timeline for d1n6ja_: