SCOP 1.67: Domain d1n56b1: 1n56 B:241-341

Lineage for d1n56b1 (1n56 B:241-341)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (3 proteins)

6. Protein DinB homolog (DBH) [100881] (2 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (11 PDB entries)

8. Domain d1n56b1: 1n56 B:241-341 [91682]
   Other proteins in same PDB: d1n56a2, d1n56b2
   complexed with 3dr, atp, ca, mg

Details for d1n56b1

PDB Entry: 1n56, 2.4 Å

PDB Description: y-family dna polymerase dpo4 in complex with dna containing abasic lesion

SCOP Domain Sequences for d1n56b1:

Sequence; same for both SEQRES and ATOM records:

>d1n56b1 d.240.1.1 (B:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d1n56b1:

• d1n56b1 is new in SCOP 1.67
  
• d1n56b1 appears in SCOP 1.69
  
• d1n56b1 appears in the current release, SCOPe 2.08