SCOP 1.73: Domain d1n51a2: 1n51 A:177-440

Lineage for d1n51a2 (1n51 A:177-440)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Aminopeptidase P, C-terminal domain [55928] (2 species)

7. Species Escherichia coli [TaxId:562] [55929] (23 PDB entries)

8. Domain d1n51a2: 1n51 A:177-440 [91679]
   Other proteins in same PDB: d1n51a1
   complexed with atn, mn

Details for d1n51a2

PDB Entry: 1n51, 2.3 Å

PDB Description: Aminopeptidase P in complex with the inhibitor apstatin

PDB Compounds: (A:) xaa-pro aminopeptidase

SCOP Domain Sequences for d1n51a2:

Sequence; same for both SEQRES and ATOM records:

>d1n51a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

Timeline for d1n51a2:

• d1n51a2 first appeared in SCOP 1.67
  
• d1n51a2 appears in SCOP 1.71
  
• d1n51a2 appears in SCOP 1.75
  
• d1n51a2 appears in the current release, SCOPe 2.08