Lineage for d1n51a2 (1n51 A:177-440)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510692Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 510693Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 510694Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 510695Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 510699Species Escherichia coli [TaxId:562] [55929] (5 PDB entries)
  8. 510701Domain d1n51a2: 1n51 A:177-440 [91679]
    Other proteins in same PDB: d1n51a1

Details for d1n51a2

PDB Entry: 1n51 (more details), 2.3 Å

PDB Description: Aminopeptidase P in complex with the inhibitor apstatin

SCOP Domain Sequences for d1n51a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n51a2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOP Domain Coordinates for d1n51a2:

Click to download the PDB-style file with coordinates for d1n51a2.
(The format of our PDB-style files is described here.)

Timeline for d1n51a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n51a1