SCOP 1.71: Domain d1n4wa2: 1n4w A:319-450

Lineage for d1n4wa2 (1n4w A:319-450)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)

6. Protein Cholesterol oxidase [54375] (2 species)

7. Species Streptomyces sp. [TaxId:1931] [54377] (10 PDB entries)

8. Domain d1n4wa2: 1n4w A:319-450 [91677]
   Other proteins in same PDB: d1n4wa1
   complexed with fad, gol, mn

Details for d1n4wa2

PDB Entry: 1n4w, 0.92 Å

PDB Description: atomic resolution structure of cholesterol oxidase @ ph 7.3 (streptomyces sp. sa-coo)

SCOP Domain Sequences for d1n4wa2:

Sequence; same for both SEQRES and ATOM records:

>d1n4wa2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

Timeline for d1n4wa2:

• d1n4wa2 first appeared in SCOP 1.67
  
• d1n4wa2 appears in SCOP 1.69
  
• d1n4wa2 appears in SCOP 1.73
  
• d1n4wa2 appears in the current release, SCOPe 2.08