Lineage for d1n4va1 (1n4v A:9-318,A:451-507)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 822279Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 822280Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 822334Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 822335Protein Cholesterol oxidase of GMC family [51914] (3 species)
  7. 822341Species Streptomyces sp. [TaxId:1931] [51916] (13 PDB entries)
  8. 822348Domain d1n4va1: 1n4v A:9-318,A:451-507 [91674]
    Other proteins in same PDB: d1n4va2
    complexed with fad, gol

Details for d1n4va1

PDB Entry: 1n4v (more details), 1 Å

PDB Description: atomic resolution structure of cholesterol oxidase @ph 5.8 (streptomyces sp. sa-coo)
PDB Compounds: (A:) cholesterol oxidase

SCOP Domain Sequences for d1n4va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4va1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernve
riikqdvt

SCOP Domain Coordinates for d1n4va1:

Click to download the PDB-style file with coordinates for d1n4va1.
(The format of our PDB-style files is described here.)

Timeline for d1n4va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4va2