Lineage for d1n4sf_ (1n4s F:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 359095Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 359214Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 359215Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 359221Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (23 PDB entries)
  8. 359240Domain d1n4sf_: 1n4s F: [91664]
    Other proteins in same PDB: d1n4sa_, d1n4sc_, d1n4se_, d1n4sg_, d1n4si_, d1n4sk_

Details for d1n4sf_

PDB Entry: 1n4s (more details), 2.6 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product

SCOP Domain Sequences for d1n4sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4sf_ a.102.4.3 (F:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1n4sf_:

Click to download the PDB-style file with coordinates for d1n4sf_.
(The format of our PDB-style files is described here.)

Timeline for d1n4sf_: