Lineage for d1n4se_ (1n4s E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647144Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 647145Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 647146Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 647193Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (27 PDB entries)
  8. 647219Domain d1n4se_: 1n4s E: [91663]
    Other proteins in same PDB: d1n4sb_, d1n4sd_, d1n4sf_, d1n4sh_, d1n4sj_, d1n4sl_

Details for d1n4se_

PDB Entry: 1n4s (more details), 2.6 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product
PDB Compounds: (E:) protein farnesyltransferase alpha subunit

SCOP Domain Sequences for d1n4se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4se_ a.118.6.1 (E:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1n4se_:

Click to download the PDB-style file with coordinates for d1n4se_.
(The format of our PDB-style files is described here.)

Timeline for d1n4se_: