Lineage for d1n4sb_ (1n4s B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774536Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 774537Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 774583Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 774608Domain d1n4sb_: 1n4s B: [91660]
    Other proteins in same PDB: d1n4sa_, d1n4sc_, d1n4se_, d1n4sg_, d1n4si_, d1n4sk_

Details for d1n4sb_

PDB Entry: 1n4s (more details), 2.6 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product
PDB Compounds: (B:) geranyltransferase type-I beta subunit

SCOP Domain Sequences for d1n4sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4sb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1n4sb_:

Click to download the PDB-style file with coordinates for d1n4sb_.
(The format of our PDB-style files is described here.)

Timeline for d1n4sb_: