Lineage for d1n4sa_ (1n4s A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745817Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 1745818Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 1745819Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 1745834Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 1745874Domain d1n4sa_: 1n4s A: [91659]
    Other proteins in same PDB: d1n4sb_, d1n4sd_, d1n4sf_, d1n4sh_, d1n4sj_, d1n4sl_
    complexed with cl, ger, grg, zn

Details for d1n4sa_

PDB Entry: 1n4s (more details), 2.6 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with ggpp and a geranylgeranylated kkksktkcvil peptide product
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1n4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4sa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1n4sa_:

Click to download the PDB-style file with coordinates for d1n4sa_.
(The format of our PDB-style files is described here.)

Timeline for d1n4sa_: