Lineage for d1n4rk_ (1n4r K:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542934Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 542935Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 542936Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 542977Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (26 PDB entries)
  8. 543019Domain d1n4rk_: 1n4r K: [91657]
    Other proteins in same PDB: d1n4rb_, d1n4rd_, d1n4rf_, d1n4rh_, d1n4rj_, d1n4rl_
    complexed with cl, mes, so4, tth, zn

Details for d1n4rk_

PDB Entry: 1n4r (more details), 2.8 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a geranylgeranylated kkksktkcvil peptide product

SCOP Domain Sequences for d1n4rk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4rk_ a.118.6.1 (K:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1n4rk_:

Click to download the PDB-style file with coordinates for d1n4rk_.
(The format of our PDB-style files is described here.)

Timeline for d1n4rk_: