Lineage for d1n4rf_ (1n4r F:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 541757Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 541951Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 542076Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 542077Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 542118Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (26 PDB entries)
  8. 542157Domain d1n4rf_: 1n4r F: [91652]
    Other proteins in same PDB: d1n4ra_, d1n4rc_, d1n4re_, d1n4rg_, d1n4ri_, d1n4rk_

Details for d1n4rf_

PDB Entry: 1n4r (more details), 2.8 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a geranylgeranylated kkksktkcvil peptide product

SCOP Domain Sequences for d1n4rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4rf_ a.102.4.3 (F:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1n4rf_:

Click to download the PDB-style file with coordinates for d1n4rf_.
(The format of our PDB-style files is described here.)

Timeline for d1n4rf_: