Lineage for d1n4re_ (1n4r E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333487Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2333488Family a.118.6.1: Protein prenylyltransferase [48440] (3 protein domains)
  6. 2333489Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2333504Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2333600Domain d1n4re_: 1n4r E: [91651]
    Other proteins in same PDB: d1n4rb_, d1n4rd_, d1n4rf_, d1n4rh_, d1n4rj_, d1n4rl_
    complexed with cl, ger, mes, so4, zn

Details for d1n4re_

PDB Entry: 1n4r (more details), 2.8 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a geranylgeranylated kkksktkcvil peptide product
PDB Compounds: (E:) Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha

SCOPe Domain Sequences for d1n4re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4re_ a.118.6.1 (E:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1n4re_:

Click to download the PDB-style file with coordinates for d1n4re_.
(The format of our PDB-style files is described here.)

Timeline for d1n4re_: