Lineage for d1n4qj_ (1n4q J:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277123Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 1277124Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 1277141Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (49 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 1277172Domain d1n4qj_: 1n4q J: [91644]
    Other proteins in same PDB: d1n4qa_, d1n4qc_, d1n4qe_, d1n4qg_, d1n4qi_, d1n4qk_
    complexed with cl, ger, mgm, zn

Details for d1n4qj_

PDB Entry: 1n4q (more details), 2.4 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
PDB Compounds: (J:) geranyltransferase type-I beta subunit

SCOPe Domain Sequences for d1n4qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4qj_ a.102.4.3 (J:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1n4qj_:

Click to download the PDB-style file with coordinates for d1n4qj_.
(The format of our PDB-style files is described here.)

Timeline for d1n4qj_: