Lineage for d1n4qh_ (1n4q H:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920404Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 920721Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 920846Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 920847Protein Protein farnesyltransferase, beta-subunit [48247] (3 species)
  7. 920895Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 920911Domain d1n4qh_: 1n4q H: [91642]
    Other proteins in same PDB: d1n4qa_, d1n4qc_, d1n4qe_, d1n4qg_, d1n4qi_, d1n4qk_
    complexed with cl, ger, mgm, zn

Details for d1n4qh_

PDB Entry: 1n4q (more details), 2.4 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide
PDB Compounds: (H:) geranyltransferase type-I beta subunit

SCOPe Domain Sequences for d1n4qh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4qh_ a.102.4.3 (H:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1n4qh_:

Click to download the PDB-style file with coordinates for d1n4qh_.
(The format of our PDB-style files is described here.)

Timeline for d1n4qh_: