Lineage for d1n4qe_ (1n4q E:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 359946Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 359947Family a.118.6.1: Protein prenylyltransferase [48440] (2 protein domains)
  6. 359948Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 359954Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (23 PDB entries)
  8. 359967Domain d1n4qe_: 1n4q E: [91639]
    Other proteins in same PDB: d1n4qb_, d1n4qd_, d1n4qf_, d1n4qh_, d1n4qj_, d1n4ql_

Details for d1n4qe_

PDB Entry: 1n4q (more details), 2.4 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide

SCOP Domain Sequences for d1n4qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4qe_ a.118.6.1 (E:) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus)}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOP Domain Coordinates for d1n4qe_:

Click to download the PDB-style file with coordinates for d1n4qe_.
(The format of our PDB-style files is described here.)

Timeline for d1n4qe_: