Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries) Uniprot Q02293 22-418 P53610 |
Domain d1n4qd_: 1n4q D: [91638] Other proteins in same PDB: d1n4qa_, d1n4qc_, d1n4qe_, d1n4qg_, d1n4qi_, d1n4qk_ |
PDB Entry: 1n4q (more details), 2.4 Å
SCOP Domain Sequences for d1n4qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4qd_ a.102.4.3 (D:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
Timeline for d1n4qd_: