Lineage for d1n4qb_ (1n4q B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446542Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 446731Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 446850Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 446851Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 446859Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (25 PDB entries)
  8. 446871Domain d1n4qb_: 1n4q B: [91636]
    Other proteins in same PDB: d1n4qa_, d1n4qc_, d1n4qe_, d1n4qg_, d1n4qi_, d1n4qk_

Details for d1n4qb_

PDB Entry: 1n4q (more details), 2.4 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with a ggpp analog and a kkksktkcvil peptide

SCOP Domain Sequences for d1n4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus)}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1n4qb_:

Click to download the PDB-style file with coordinates for d1n4qb_.
(The format of our PDB-style files is described here.)

Timeline for d1n4qb_: