Lineage for d1n4ph_ (1n4p H:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 646026Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 646151Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins)
  6. 646152Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 646196Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (27 PDB entries)
  8. 646230Domain d1n4ph_: 1n4p H: [91630]
    Other proteins in same PDB: d1n4pa_, d1n4pc_, d1n4pe_, d1n4pg_, d1n4pi_, d1n4pk_

Details for d1n4ph_

PDB Entry: 1n4p (more details), 2.65 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with geranylgeranyl diphosphate
PDB Compounds: (H:) geranyltransferase type-I beta subunit

SCOP Domain Sequences for d1n4ph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ph_ a.102.4.3 (H:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOP Domain Coordinates for d1n4ph_:

Click to download the PDB-style file with coordinates for d1n4ph_.
(The format of our PDB-style files is described here.)

Timeline for d1n4ph_: