Lineage for d1n4na_ (1n4n A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257552Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2257847Family g.3.7.5: Plant defensins [57170] (9 proteins)
  6. 2257865Protein Floral defensin 1 [103556] (3 species)
    flower-specific gamma-thionin
  7. 2257866Species Garden petunia (Petunia x hybrida), PHD1 [TaxId:4102] [103558] (1 PDB entry)
  8. 2257867Domain d1n4na_: 1n4n A: [91620]

Details for d1n4na_

PDB Entry: 1n4n (more details)

PDB Description: structure of the plant defensin phd1 from petunia hybrida
PDB Compounds: (A:) floral defensin-like protein 1

SCOPe Domain Sequences for d1n4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4na_ g.3.7.5 (A:) Floral defensin 1 {Garden petunia (Petunia x hybrida), PHD1 [TaxId: 4102]}
atckaecptwdsvcinkkpcvacckkakfsdghcskilrrclctkec

SCOPe Domain Coordinates for d1n4na_:

Click to download the PDB-style file with coordinates for d1n4na_.
(The format of our PDB-style files is described here.)

Timeline for d1n4na_: