Lineage for d1n4ha_ (1n4h A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747489Protein Orphan nuclear receptor ROR-beta [74794] (1 species)
  7. 1747490Species Norway rat (Rattus norvegicus) [TaxId:10116] [74795] (3 PDB entries)
  8. 1747493Domain d1n4ha_: 1n4h A: [91618]
    complexed with a co-activator peptide, chain B
    complexed with rea

Details for d1n4ha_

PDB Entry: 1n4h (more details), 2.1 Å

PDB Description: Characterization of ligands for the orphan nuclear receptor RORbeta
PDB Compounds: (A:) Nuclear receptor ROR-beta

SCOPe Domain Sequences for d1n4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ha_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tmseidriaqniikshletcqytmeelhqlawqthtyeeikayqsksrealwqqcaiqit
haiqyvvefakritgfmelcqndqilllksgclevvlvrmcrafnplnntvlfegkyggm
qmfkalgsddlvneafdfaknlcslqlteeeialfssavlispdrawlleprkvqklqek
iyfalqhviqknhlddetlakliakiptitavcnlhgeklqvfkqshpdivntlfpplyk
elfn

SCOPe Domain Coordinates for d1n4ha_:

Click to download the PDB-style file with coordinates for d1n4ha_.
(The format of our PDB-style files is described here.)

Timeline for d1n4ha_: