Lineage for d1n4ca1 (1n4c A:5-182)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979943Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1979944Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
    Pfam PF00226
  6. 1979945Protein Auxilin J-domain [88969] (1 species)
  7. 1979946Species Cow (Bos taurus) [TaxId:9913] [88970] (7 PDB entries)
  8. 1979954Domain d1n4ca1: 1n4c A:5-182 [91617]
    Other proteins in same PDB: d1n4ca2
    includes unstructured clathrin substrate binding region; residues 1-70

Details for d1n4ca1

PDB Entry: 1n4c (more details)

PDB Description: nmr structure of the j-domain and clathrin substrate binding domain of bovine auxilin
PDB Compounds: (A:) Auxilin

SCOPe Domain Sequences for d1n4ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ca1 a.2.3.1 (A:5-182) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}
spefsmphsspqnrpnynvsfssmpggqnergkaaanlegkqkaadfedllsgqgfnahk
dkkgprtiaemrkeemakemdpeklkilewiegkernirallstmhtvlwagetkwkpvg
madlvtpeqvkkvyrkavlvvhpdkatgqpyeqyakmifmelndawsefenqgqkply

SCOPe Domain Coordinates for d1n4ca1:

Click to download the PDB-style file with coordinates for d1n4ca1.
(The format of our PDB-style files is described here.)

Timeline for d1n4ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ca2