Lineage for d1n48a2 (1n48 A:1-240)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618622Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 618623Protein DinB homolog (DBH) [100889] (2 species)
  7. 618629Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (11 PDB entries)
  8. 618637Domain d1n48a2: 1n48 A:1-240 [91616]
    Other proteins in same PDB: d1n48a1
    complexed with 3dr, atp, ca

Details for d1n48a2

PDB Entry: 1n48 (more details), 2.2 Å

PDB Description: Y-family DNA polymerase Dpo4 in complex with DNA containing abasic lesion

SCOP Domain Sequences for d1n48a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n48a2 e.8.1.7 (A:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d1n48a2:

Click to download the PDB-style file with coordinates for d1n48a2.
(The format of our PDB-style files is described here.)

Timeline for d1n48a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n48a1