Lineage for d1n3tb_ (1n3t B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416305Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 416306Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 416307Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 416308Protein GTP cyclohydrolase I [55622] (3 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 416309Species Escherichia coli [TaxId:562] [55623] (7 PDB entries)
  8. 416401Domain d1n3tb_: 1n3t B: [91594]

Details for d1n3tb_

PDB Entry: 1n3t (more details), 3.2 Å

PDB Description: biosynthesis of pteridins. reaction mechanism of gtp cyclohydrolase i

SCOP Domain Sequences for d1n3tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3tb_ d.96.1.1 (B:) GTP cyclohydrolase I {Escherichia coli}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstcehhfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
svkargirdatsattttslgglfkssqntrheflravrhhn

SCOP Domain Coordinates for d1n3tb_:

Click to download the PDB-style file with coordinates for d1n3tb_.
(The format of our PDB-style files is described here.)

Timeline for d1n3tb_: