Lineage for d1n3re_ (1n3r E:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730177Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 730178Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 730179Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 730180Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 730181Species Escherichia coli [TaxId:562] [55623] (7 PDB entries)
  8. 730236Domain d1n3re_: 1n3r E: [91572]

Details for d1n3re_

PDB Entry: 1n3r (more details), 2.8 Å

PDB Description: biosynthesis of pteridins. reaction mechanism of gtp cyclohydrolase i
PDB Compounds: (E:) GTP cyclohydrolase I

SCOP Domain Sequences for d1n3re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3re_ d.96.1.1 (E:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstceshfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhh

SCOP Domain Coordinates for d1n3re_:

Click to download the PDB-style file with coordinates for d1n3re_.
(The format of our PDB-style files is described here.)

Timeline for d1n3re_: