SCOP 1.73: Domain d1n3ha_: 1n3h A:

Lineage for d1n3ha_ (1n3h A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
   Pfam PF00640

6. Protein Shc adaptor protein [50760] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries)

8. Domain d1n3ha_: 1n3h A: [91564]

Details for d1n3ha_

PDB Entry: 1n3h

PDB Description: coupling of folding and binding in the ptb domain of the signaling protein shc

PDB Compounds: (A:) SHC Transforming protein

SCOP Domain Sequences for d1n3ha_:

Sequence; same for both SEQRES and ATOM records:

>d1n3ha_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
mnklsggggrrtrveggqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcv
evlqsmraldfntrtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagm
pitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachil
ecpeglaqdvistigqafelrfkqylr

Timeline for d1n3ha_:

• d1n3ha_ first appeared in SCOP 1.67
  
• d1n3ha_ appears in SCOP 1.71
  
• d1n3ha_ appears in SCOP 1.75
  
• d1n3ha_ appears in the current release, SCOPe 2.08