Lineage for d1n2la_ (1n2l A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138453Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2138454Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2138572Family c.76.1.2: Arylsulfatase [53653] (4 protein domains)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2138573Protein Arylsulfatase A [53654] (1 species)
  7. 2138574Species Human (Homo sapiens) [TaxId:9606] [53655] (7 PDB entries)
  8. 2138581Domain d1n2la_: 1n2l A: [91560]
    covalent reaction intermediate
    complexed with ca, ndg

Details for d1n2la_

PDB Entry: 1n2l (more details), 3.2 Å

PDB Description: Crystal structure of a covalent intermediate of endogenous human arylsulfatase A
PDB Compounds: (A:) arylsulfatase a

SCOPe Domain Sequences for d1n2la_:

Sequence, based on SEQRES records: (download)

>d1n2la_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslstpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqrqdrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllggvagatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpa
cchcpd

Sequence, based on observed residues (ATOM records): (download)

>d1n2la_ c.76.1.2 (A:) Arylsulfatase A {Human (Homo sapiens) [TaxId: 9606]}
rppnivlifaddlgygdlgcyghpssttpnldqlaagglrftdfyvpvslstpsraallt
grlpvrmgmypgvlvpssrgglpleevtvaevlaargyltgmagkwhlgvgpegaflpph
qgfhrflgipyshdqgpcqnltcfppatpcdggcdqglvpipllanlsveaqppwlpgle
arymafahdlmadaqrqdrpfflyyashhthypqfsgqsfaersgrgpfgdslmeldaav
gtlmtaigdlglleetlviftadngpetmrmsrggcsgllrcgkgttyeggvrepalafw
pghiapgvthelassldllptlaalagaplpnvtldgfdlsplllgtgksprqslffyps
ypdevrgvfavrtgkykahfftqgsahsdttadpachasssltaheppllydlskdpgen
ynllggatpevlqalkqlqllkaqldaavtfgpsqvargedpalqicchpgctprpacch
cpd

SCOPe Domain Coordinates for d1n2la_:

Click to download the PDB-style file with coordinates for d1n2la_.
(The format of our PDB-style files is described here.)

Timeline for d1n2la_: