SCOPe 2.08: Domain d1n2da_: 1n2d A:

Lineage for d1n2da_ (1n2d A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Light Chain Mlc1p [81756] (1 species)
   light chain of class V myosin

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81757] (3 PDB entries)

8. Domain d1n2da_: 1n2d A: [91557]
   complexed with iq2 and iq3 fragment of a class V myosin myo2p, chain C

Details for d1n2da_

PDB Entry: 1n2d, 2 Å

PDB Description: ternary complex of mlc1p bound to iq2 and iq3 of myo2p, a class v myosin

PDB Compounds: (A:) Myosin light chain

SCOPe Domain Sequences for d1n2da_:

Sequence; same for both SEQRES and ATOM records:

>d1n2da_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atrankdiftlfdkkgqgaiakdslgdylraigynptnqlvqdiinadsslrdassltld
qitglievnekeldattkaktedfvkafqvfdkestgkvsvgdlrymltglgekltdaev
dellkgvevdsngeidykkfiedvlrq

Timeline for d1n2da_:

• d1n2da_ first appeared in SCOP 1.67
  
• d1n2da_ appears in SCOPe 2.07