Lineage for d1n2ab1 (1n2a B:81-201)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326169Protein Class beta GST [81357] (4 species)
  7. 2326170Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)
  8. 2326172Domain d1n2ab1: 1n2a B:81-201 [91555]
    Other proteins in same PDB: d1n2aa2, d1n2ab2
    complexed with gts

Details for d1n2ab1

PDB Entry: 1n2a (more details), 1.9 Å

PDB Description: Crystal Structure of a Bacterial Glutathione Transferase from Escherichia coli with Glutathione Sulfonate in the Active Site
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1n2ab1:

Sequence, based on SEQRES records: (download)

>d1n2ab1 a.45.1.1 (B:81-201) Class beta GST {Escherichia coli [TaxId: 562]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

Sequence, based on observed residues (ATOM records): (download)

>d1n2ab1 a.45.1.1 (B:81-201) Class beta GST {Escherichia coli [TaxId: 562]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaeglk

SCOPe Domain Coordinates for d1n2ab1:

Click to download the PDB-style file with coordinates for d1n2ab1.
(The format of our PDB-style files is described here.)

Timeline for d1n2ab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n2ab2