SCOPe 2.05: Domain d1n2ab1: 1n2a B:81-201

Lineage for d1n2ab1 (1n2a B:81-201)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class beta GST [81357] (4 species)

7. Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)

8. Domain d1n2ab1: 1n2a B:81-201 [91555]
   Other proteins in same PDB: d1n2aa2, d1n2ab2
   complexed with gts

Details for d1n2ab1

PDB Entry: 1n2a, 1.9 Å

PDB Description: Crystal Structure of a Bacterial Glutathione Transferase from Escherichia coli with Glutathione Sulfonate in the Active Site

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1n2ab1:

Sequence, based on SEQRES records:

>d1n2ab1 a.45.1.1 (B:81-201) Class beta GST {Escherichia coli [TaxId: 562]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

Sequence, based on observed residues (ATOM records):

>d1n2ab1 a.45.1.1 (B:81-201) Class beta GST {Escherichia coli [TaxId: 562]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaeglk

Timeline for d1n2ab1:

• d1n2ab1 first appeared in SCOP 1.67
  
• d1n2ab1 appears in SCOPe 2.04
  
• d1n2ab1 appears in SCOPe 2.06
  
• d1n2ab1 appears in the current release, SCOPe 2.08