| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class beta GST [81368] (4 species) |
| Species Escherichia coli [TaxId:562] [52883] (3 PDB entries) |
| Domain d1n2aa2: 1n2a A:1-80 [91554] Other proteins in same PDB: d1n2aa1, d1n2ab1 complexed with gts |
PDB Entry: 1n2a (more details), 1.9 Å
SCOPe Domain Sequences for d1n2aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
mklfykpgacslashitlresgkdftlvsvdlmkkrlengddyfavnpkgqvpalllddg
tlltegvaimqyladsvpdr
Timeline for d1n2aa2: